Recombinant human TMC8 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag24972
Synonyms
TMC8, EV2, EVER2, EVIN2, transmembrane channel like 8
Validation Data Gallery
Product Information
| Peptide Sequence |
QTQANARAIHRLRKQLVWQVQEKWHLVEDLSRLLPEPGPSDSPGPKYPASQASRPQSFCPGCPCPGSPGHQAPRPGPSVVDAAGLRSPCPGQHGAPASARRFRFPSGAEL
(617-726 aa encoded by BC141865) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
