Validation Data Gallery
Tested Applications
| Positive WB detected in | HL-60 cells, HT-29 cells, HeLa cells, SKOV-3 cells |
| Positive IF/ICC detected in | HT-29 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 81 publications below |
| IHC | See 26 publications below |
| IF | See 7 publications below |
Product Information
16644-1-AP targets TIMP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rabbit, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10006 Product name: Recombinant human TIMP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC000866 Sequence: MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA 相同性解析による交差性が予測される生物種 |
| Full Name | TIMP metallopeptidase inhibitor 1 |
| Calculated molecular weight | 23 kDa |
| Observed molecular weight | 23 kDa |
| GenBank accession number | BC000866 |
| Gene Symbol | TIMP1 |
| Gene ID (NCBI) | 7076 |
| RRID | AB_2878292 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01033 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TIMP1 is a member of the family of matrix metalloproteinase inhibitors, which contains four members (TIMP1, TIMP2, TIMP3, and TIMP4). Tissue inhibitors of metalloproteinases (TIMPs) are multifaceted molecules that exhibit properties beyond their classical proteinase inhibitory function. TIMP1 has several MMP-independent functions such as modulation of angiogenesis, promotion of cell proliferation, and inhibition of apoptosis. TIMP1 plays important role in cell cycle regulation and cancer progression. Recently, clinical studies have shown that the aberrant expression of TIMP1 is associated with an unfavorable prognosis in a series of tumors, such as gastric cancer, papillary thyroid carcinoma, cutaneous melanoma and breast cancer. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIMP1 antibody 16644-1-AP | Download protocol |
| WB protocol for TIMP1 antibody 16644-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Acta Pharm Sin B TIMP1 preserves the blood-brain barrier through interacting with CD63/integrin β 1 complex and regulating downstream FAK/RhoA signaling. | ||
Proc Natl Acad Sci U S A Addiction to Golgi-resident PI4P synthesis in chromosome 1q21.3-amplified lung adenocarcinoma cells. | ||
J Neuroinflammation Identification of TIMP1 as an inflammatory biomarker associated with temporal lobe epilepsy based on integrated bioinformatics and experimental analyses | ||
Cell Death Dis α1,3-fucosylation of MEST promotes invasion potential of cytotrophoblast cells by activating translation initiation | ||
Biomed Pharmacother TrxR/Trx inhibitor butaselen ameliorates pulmonary fibrosis by suppressing NF-κB/TGF-β1/Smads signaling | ||
Cell Mol Gastroenterol Hepatol Sestrin Proteins Protect Against Lipotoxicity-Induced Oxidative Stress in the Liver via Suppression of C-Jun N-Terminal Kinases. |



