Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver tissue, human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:100-1:600 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 5 publications below |
| IHC | See 4 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
13054-1-AP targets THRSP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3721 Product name: Recombinant human THRSP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC031989 Sequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW 相同性解析による交差性が予測される生物種 |
| Full Name | thyroid hormone responsive (SPOT14 homolog, rat) |
| Calculated molecular weight | 146 aa, 17 kDa |
| Observed molecular weight | 20 kDa |
| GenBank accession number | BC031989 |
| Gene Symbol | THRSP |
| Gene ID (NCBI) | 7069 |
| RRID | AB_2877906 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92748 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
THRSP (Thyroid hormone-inducible hepatic protein) is a protein that in humans is encoded by the THRSP gene. The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism (RefSeq). This antibody works well in IHC, WB and IF.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for THRSP antibody 13054-1-AP | Download protocol |
| IHC protocol for THRSP antibody 13054-1-AP | Download protocol |
| IP protocol for THRSP antibody 13054-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Med Insulin-inducible THRSP maintains mitochondrial function and regulates sphingolipid metabolism in human adipocytes. | ||
Sci Rep Elevated serum S14 levels are associated with more severe liver steatosis by ultrasonography. | ||
Mol Cell Endocrinol MiR-451a attenuates free fatty acids-mediated hepatocyte steatosis by targeting the thyroid hormone responsive spot 14 gene.
| ||
Medicine (Baltimore) Serum Spot 14 concentration is negatively associated with thyroid-stimulating hormone level. | ||
Cell Death Discov Thyroid hormones inhibit tumor progression and enhance the antitumor activity of lenvatinib in hepatocellular carcinoma via reprogramming glucose metabolism | ||
Hepatology MIF-mediated crosstalk between THRSP+ hepatocytes and CD74+ lipid-associated macrophages in hepatic periportal zone drives MASH
|








