Validation Data Gallery
Tested Applications
| Positive WB detected in | human stomach tissue, human urine sample |
| Positive IP detected in | mouse stomach tissue |
| Positive IHC detected in | human stomach tissue, human stomach cancer tissue, mouse stomach tissue, mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse stomach tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below |
| IHC | See 27 publications below |
| IF | See 20 publications below |
Product Information
13681-1-AP targets TFF2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, hamster, gerbil |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4537 Product name: Recombinant human TFF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY 相同性解析による交差性が予測される生物種 |
| Full Name | trefoil factor 2 |
| Calculated molecular weight | 129 aa, 14 kDa |
| Observed molecular weight | 18-20 kDa |
| GenBank accession number | BC032820 |
| Gene Symbol | TFF2 |
| Gene ID (NCBI) | 7032 |
| RRID | AB_10598321 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03403 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TFF2 antibody 13681-1-AP | Download protocol |
| IHC protocol for TFF2 antibody 13681-1-AP | Download protocol |
| IP protocol for TFF2 antibody 13681-1-AP | Download protocol |
| WB protocol for TFF2 antibody 13681-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Genet Systematic identification of cell-fate regulatory programs using a single-cell atlas of mouse development. | ||
Nat Cell Biol Lgr5-expressing chief cells drive epithelial regeneration and cancer in the oxyntic stomach. | ||
Nat Cell Biol A tumour-resident Lgr5+ stem-cell-like pool drives the establishment and progression of advanced gastric cancers. | ||
Gut Dissecting transcriptional heterogeneity in primary gastric adenocarcinoma by single cell RNA sequencing. | ||
Gastroenterology Induction of gastric cancer by successive oncogenic activation in the corpus. |














