Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, Y79 cells, pig brain tissue, SH-SY5Y cells, U-251 cells, Neuro-2a cells, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | human gliomas tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:30000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 22 publications below |
| IHC | See 1 publications below |
| IF | See 5 publications below |
Product Information
66499-1-Ig targets TAU in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, rabbit |
| Host / Isotype | Mouse / IgG2c |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21926 Product name: Recombinant human TAU protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 5-208 aa of BC000558 Sequence: PRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENL 相同性解析による交差性が予測される生物種 |
| Full Name | microtubule-associated protein tau |
| Calculated molecular weight | 37-46, 79-81 kDa |
| Observed molecular weight | 100 kDa |
| GenBank accession number | BC000558 |
| Gene Symbol | TAU |
| Gene ID (NCBI) | 4137 |
| RRID | AB_2881863 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P10636 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The microtubule-associated protein TAU (MAPT or TAU) is encoded by MAPT gene, which locates on human chromosome 17q21, binds to the tubulin subunit of microtubule and promotes its assembly and stability. Most TAU is expressed in neurons, and TAU isoform is expressed in the peripheral nervous system while the others are expressed in the central nervous system. TAU links axonal microtubules with C-terminus to neural plasma membrane components with its N-terminus, suggesting the participation in intracellular signal transduction and neuron's development and viability. Various isoforms of Tau exist due to the alternative splicing, and short isoforms around 45-69 kDa and long isoforms around 100-110 kDa have been reported in different literature (PMID:8752131,15965697, 12485403).Present monoclonal anti-Tau antibody can detect approx 100-kDa bands in brain tissues.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TAU antibody 66499-1-Ig | Download protocol |
| WB protocol for TAU antibody 66499-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
Free Radic Biol Med Reprimo (RPRM) mediates neuronal ferroptosis via CREB-Nrf2/SCD1 pathways in radiation-induced brain injury | ||
Acta Pharmacol Sin Long-term running exercise alleviates cognitive dysfunction in APP/PSEN1 transgenic mice via enhancing brain lysosomal function. | ||
Int J Mol Sci Neuroprotection and Mechanism of Gas-miR36-5p from Gastrodia elata in an Alzheimer's Disease Model by Regulating Glycogen Synthase Kinase-3β | ||
Front Aging Neurosci Salidroside Ameliorates Alzheimer's Disease by Targeting NLRP3 Inflammasome-Mediated Pyroptosis. | ||
Mol Med Eriodictyol ameliorates cognitive dysfunction in APP/PS1 mice by inhibiting ferroptosis via vitamin D receptor-mediated Nrf2 activation. |






