Validation Data Gallery
Product Information
Alpaca anti-Strep-Tag VHH, purified recombinant binding protein
| Applications | Suitable for conjugation to beads, plates, and surfaces via NHS-chemistry |
| Specificity/Target | Binds specifically to the peptide sequence SAWSHPQFEK, also known as Strep-Tag® or Strep-TagII®, fused to a protein of interest at N- or C-terminal position. In addition, this VHH binds to the peptide sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, also known as Twin-Strep-Tag®, fused to a protein of interest at N- or C-terminal position. |
| Conjugate | Unconjugated |
| Type | Nanobody |
| Class | Recombinant |
| Host | Alpaca |
| Affinity (KD) | 480 nM for N-terminal Strep-Tag® and 600 nM for C-terminal Strep-Tag® |
| Molecular Weight | 15 kDa |
| RRID | AB_3107052 |
| Storage Buffer | 25 mM TAPS pH 8.5, 500 mM NaCl, 5 mM EDTA, preservative: 0.09% sodium azide |
| Storage Condition | Shipped at ambient temperature. Upon receipt store at +4°C. Stable for one year. Do not freeze! |
| Size | 250 µg |
Documentation
| SDS |
|---|
| qt_SDS, recombinant binding protein (EN) |
| Datasheet |
|---|
| anti-Strep recombinant VHH, unconjugated Datasheet |

