Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293T |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 6 publications below |
| WB | See 17 publications below |
| IHC | See 2 publications below |
| IF | See 4 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
66297-1-Ig targets Sestrin 2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, pig, rat samples.
| Tested Reactivity | human, pig, rat |
| Cited Reactivity | human, mouse, rat, pig, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20638 Product name: Recombinant human Sestrin2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 132-480 aa of BC013304 Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT 相同性解析による交差性が予測される生物種 |
| Full Name | sestrin 2 |
| Calculated molecular weight | 54 kDa |
| Observed molecular weight | 54 kDa |
| GenBank accession number | BC013304 |
| Gene Symbol | SESN2/Sestrin 2 |
| Gene ID (NCBI) | 83667 |
| RRID | AB_2881680 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P58004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 2 is implicated in the regulation of cell survival, in cellular responses to different stress conditions, and also acts as a positive regulator of autophagy. Sestrin 2 is approximately a 57.6kDa protein (480 amino acids).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Sestrin 2 antibody 66297-1-Ig | Download protocol |
| IHC protocol for Sestrin 2 antibody 66297-1-Ig | Download protocol |
| WB protocol for Sestrin 2 antibody 66297-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Biol Toxicol Induction of Sestrin2 by pterostilbene suppresses ethanol-triggered hepatocyte senescence by degrading CCN1 via p62-dependent selective autophagy.
| ||
Front Cell Dev Biol Histone Demethylase JMJD3 Mediated Doxorubicin-Induced Cardiomyopathy by Suppressing SESN2 Expression. | ||
Osteoarthritis Cartilage Suppression of Sestrins in aging and osteoarthritic cartilage: dysfunction of an important stress defense mechanism. | ||
J Nutr Intermittent Bolus Compared With Continuous Feeding Enhances Insulin and Amino Acid Signaling to Translation Initiation in Skeletal Muscle of Neonatal Pigs. | ||
Cell Tissue Res Sestrin2 attenuates renal damage by regulating Hippo pathway in diabetic nephropathy. | ||
Am J Physiol Endocrinol Metab Prematurity blunts the insulin- and amino acid-induced stimulation of translation initiation and protein synthesis in skeletal muscle of neonatal pigs. |








