Validation Data Gallery
Tested Applications
| Positive WB detected in | Daudi cells, Raji cells, Ramos cells |
| Positive IHC detected in | human liver cancer tissue, human appendicitis tissue, human spleen tissue, human kidney tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | Ramos cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
| IHC | See 2 publications below |
Product Information
14858-1-AP targets SYK in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6657 Product name: Recombinant human SYK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 368-635 aa of BC001645 Sequence: KLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN 相同性解析による交差性が予測される生物種 |
| Full Name | spleen tyrosine kinase |
| Calculated molecular weight | 72 kDa |
| Observed molecular weight | 66-72 kDa |
| GenBank accession number | BC001645 |
| Gene Symbol | SYK |
| Gene ID (NCBI) | 6850 |
| ENSEMBL Gene ID | ENSG00000165025 |
| RRID | AB_2878086 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43405 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SYK belongs to the protein kinase superfamily, Tyr protein kinase family and SYK/ZAP-70 subfamily. It is positive effector of BCR-stimulated responses. SYK couples the B-cell antigen receptor (BCR) to the mobilization of calcium ion either through a phosphoinositide 3-kinase-dependent pathway, when not phosphorylated on tyrosines of the linker region, or through a phospholipase C-gamma-dependent pathway It phosphorylates USP25 and regulates its intracellular levels. SYK also promotes liver fibrosis by activation of hepatic stellate cells and acts as a biomarker for human hepatocellular carcinoma. (PMID: 29537660) SYK can be detected 66-72 kDa in human and mouse (PMID: 37661351).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SYK antibody 14858-1-AP | Download protocol |
| WB protocol for SYK antibody 14858-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Food Funct Synergistic effects of L-theanine and epigallocatechin gallate in alleviating ovalbumin allergy by regulating intestinal immunity through inhibition of mast cell degranulation | ||
Front Genet SYK Is Associated With Malignant Phenotype and Immune Checkpoints in Diffuse Glioma. | ||
Animals (Basel) Equus β-Defensin-1 Regulates Innate IMMUNE Response in S. aureus-Infected Mouse Monocyte Macrophage | ||
J Ethnopharmacol Yiqi Kaimi prescription regulates protein phosphorylation to promote intestinal motility in slow transit constipation | ||
Res Vet Sci TYROBP modulates NFκB phosphorylation and SQSTM1 expression in macrophages during Brucella Abortus LPS infection | ||
Brain Res Inhibition of TREM-1 alleviates neuroinflammation by modulating microglial polarization via SYK/p38MAPK signaling pathway after traumatic brain injury |













