Validation Data Gallery
Tested Applications
| Positive WB detected in | human liver tissue, L02 cells, mouse liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Hela cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
Product Information
15075-1-AP targets SUOX in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7146 Product name: Recombinant human SUOX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 182-545 aa of BC065193 Sequence: RHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP 相同性解析による交差性が予測される生物種 |
| Full Name | sulfite oxidase |
| Calculated molecular weight | 60 kDa |
| Observed molecular weight | 52 kDa, 60 kDa |
| GenBank accession number | BC065193 |
| Gene Symbol | SUOX |
| Gene ID (NCBI) | 6821 |
| RRID | AB_2198558 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51687 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SUOX(sulfite oxidase) catalyzes the oxidation of sulfite to sulfate, the terminal reaction in the oxidative degradation pathway of the sulfur-containing amino acids cysteine and methionine. The enzyme is a dimer of identical subunits and is located in the intermembrane space of mitochondria(PMID:9600976). Defects in SUOX are the cause of isolated sulfite oxidase deficiency (ISOD).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SUOX antibody 15075-1-AP | Download protocol |
| IHC protocol for SUOX antibody 15075-1-AP | Download protocol |
| IF protocol for SUOX antibody 15075-1-AP | Download protocol |
| IP protocol for SUOX antibody 15075-1-AP | Download protocol |
| FC protocol for SUOX antibody 15075-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EMBO Mol Med CoQ deficiency causes disruption of mitochondrial sulfide oxidation, a new pathomechanism associated with this syndrome. | ||
Antioxid Redox Signal The Cysteine Dioxgenase Knockout Mouse: Altered Cysteine Metabolism in Nonhepatic Tissues Leads to Excess H2S/HS(-) Production and Evidence of Pancreatic and Lung Toxicity. | ||
Hum Mol Genet Coenzyme Q10 modulates sulfide metabolism and links the mitochondrial respiratory chain to pathways associated to one carbon metabolism. | ||
Toxicol Lett Dioscin, a natural steroid saponin, shows remarkable protective effect against acetaminophen-induced liver damage in vitro and in vivo. | ||
Onco Targets Ther Exploring Protein Expression Profiles in Lung Cancer Insufficient Microwave Ablation: Implications for Recurrence |






