Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, NIH/3T3 cells, PC-12 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 32 publications below |
| IF | See 3 publications below |
| IP | See 9 publications below |
| CoIP | See 2 publications below |
Product Information
10329-1-AP targets SUMO1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0414 Product name: Recombinant human SUMO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC006462 Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV 相同性解析による交差性が予測される生物種 |
| Full Name | SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) |
| Calculated molecular weight | 12 kDa |
| Observed molecular weight | 12~18 kDa, 80-90 kDa |
| GenBank accession number | BC006462 |
| Gene Symbol | SUMO1 |
| Gene ID (NCBI) | 7341 |
| RRID | AB_2286872 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63165 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Small ubiquitin-related modifier 1 (SUMO1) belongs to the ubiquitin family and the SUMO subfamily as it contains 1 ubiquitin-like domain and is also 18% identical to ubiquitin (PMID: 9654451).
1. What is the molecular weight of SUMO1?
The molecular weight of SUMO1 is 12 kDa.
2. What is the cellular localization of SUMO1?
SUMO1 is located in the nuclear membrane and is recruited by BCL11A to the nuclear body (PMID: 18681895).
3. What modifications is SUMO1 subjected to?
SUMO1 function occurs after the cleavage of its precursor form by SENP1 or SENP2 (PMID: 27576863). Polymeric SUMO1 chains also undergo polyubiquitination by RNF4 (PMID: 18408734).
4. What is the function of SUMO1?
SUMO1 post-translationally modifies many proteins that have roles in an array of processes including transcriptional regulation, chromatin structure, and DNA repair. SUMO1 can covalently attach itself to protein as a monomer or a lysine-linked polymer via an isopeptide bond (PMID:11124955). This SUMO modification can regulate the localization and activity of the affected proteins.
5. What is SUMO1's involvement in disease?
Defects in SUMO1 as a result of a chromosomal translocation are associated with non-syndromic orofacial cleft type 10, or non-syndromic cleft lip, and are associated with cleft palate in two-thirds of cases (PMID: 18983974).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SUMO1 antibody 10329-1-AP | Download protocol |
| IHC protocol for SUMO1 antibody 10329-1-AP | Download protocol |
| IP protocol for SUMO1 antibody 10329-1-AP | Download protocol |
| WB protocol for SUMO1 antibody 10329-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Acta Pharm Sin B SAE1 promotes tumor cell malignancy via SUMOylation and liquid-liquid phase separation facilitated nuclear export of p27 | ||
Sci Adv XAF1 promotes anti-RNA virus immune responses by regulating chromatin accessibility | ||
Cell Death Differ ZNF451 collaborates with RNF8 to regulate RNF168 localization and amplify ubiquitination signaling to promote DNA damage repair and regulate radiosensitivity | ||
Cell Death Dis Ubc9 regulates the expression of MHC II in dendritic cells to enhance DSS-induced colitis by mediating RBPJ SUMOylation | ||
Int J Biol Macromol SUMOylation of GMFB regulates its stability and function in retinal pigment epithelial cells under hyperglycemia | ||
Theranostics Chlorogenic acid effectively treats cancers through induction of cancer cell differentiation. |





