Validation Data Gallery
Tested Applications
| Positive WB detected in | pig brain tissue, fetal human brain tissue, rat brain tissue, Y79 cells, rabbit brain tissue, mouse brain tissue |
| Positive IHC detected in | rat brain tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:40000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 10 publications below |
| IF | See 2 publications below |
Product Information
66437-1-Ig targets Syntaxin 1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10257 Product name: Recombinant human STX1B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-263 aa of BC062298 Sequence: MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK 相同性解析による交差性が予測される生物種 |
| Full Name | syntaxin 1B |
| Calculated molecular weight | 288 aa, 33 kDa |
| Observed molecular weight | 33 kDa, 55 kDa |
| GenBank accession number | BC062298 |
| Gene Symbol | STX1B |
| Gene ID (NCBI) | 112755 |
| RRID | AB_2881807 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P61266 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Syntaxins are a family of transmembrane proteins that belong to the SNARE complex (PMID: 11737951). In conjunction with other SNAREs and with the cytoplasmic NSF and SNAP proteins, syntaxins mediate vesicle fusion in diverse vesicular transport processes along the exocytic and the endocytic pathway (PMID: 11737951). Syntaxin 1A and 1B, two closely related isoforms of syntaxin 1, are involved in synaptic vesicle docking and fusion during neurotransmitter release (PMID: 7690687; 1321498; 18691641). This antibody raised against 1-263 aa of human syntaxin 1B detects a ~33 kDa band of syntaxin 1 and an additional band of 55-60 kDa, which probably represents a syntaxin 1 dimer (PMID: 10100611). This antibody may react with both Syntaxin 1B and Syntaxin 1A.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Syntaxin 1B antibody 66437-1-Ig | Download protocol |
| IHC protocol for Syntaxin 1B antibody 66437-1-Ig | Download protocol |
| WB protocol for Syntaxin 1B antibody 66437-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Identification of genes associated with cortical malformation using a transposon-mediated somatic mutagenesis screen in mice.
| ||
J Neuroinflammation Transient neuroinflammation following surgery contributes to long-lasting cognitive decline in elderly rats via dysfunction of synaptic NMDA receptor. | ||
Clin Sci (Lond) Chronic hepatitis C virus infection impairs insulin secretion by regulation of p38δ MAPK-dependent exocytosis in pancreatic β-cells. | ||
Brain Commun Transcriptomic analysis of human brains with Alzheimer's disease reveals the altered expression of synaptic genes linked to cognitive deficits. | ||
Nat Commun Munc18 and Munc13 serve as a functional template to orchestrate neuronal SNARE complex assembly. |









