Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, rat brain tissue, NIH/3T3 cells, mouse brain tissue, HEK-293T cells, HeLa cells, Jurkat cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Hela cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
21624-1-AP targets STRN in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15984 Product name: Recombinant human STRN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-403 aa of BC106879 Sequence: NRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLTYDIANNKDALRKT 相同性解析による交差性が予測される生物種 |
| Full Name | striatin, calmodulin binding protein |
| Calculated molecular weight | 780 aa, 86 kDa |
| Observed molecular weight | 110 kDa |
| GenBank accession number | BC106879 |
| Gene Symbol | STRN |
| Gene ID (NCBI) | 6801 |
| RRID | AB_10863122 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43815 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
STRN (Striatin), a 780-amino acid protein, was identified and cloned more than a decade ago. In adult mammals, striatin is mainly expressed in neurons of both the central and peripheral nervous systems with very high levels of expression in the striatum, hence its name. STRN-ALK fusion may be a potential therapeutic target in the aggressive forms of thyroid cancer (PMID: 24475247).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for STRN antibody 21624-1-AP | Download protocol |
| IF protocol for STRN antibody 21624-1-AP | Download protocol |
| IHC protocol for STRN antibody 21624-1-AP | Download protocol |
| IP protocol for STRN antibody 21624-1-AP | Download protocol |
| WB protocol for STRN antibody 21624-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Cell Dev Biol Striatin Is Required for Hearing and Affects Inner Hair Cells and Ribbon Synapses.
| ||
J Biol Chem Heavy Metal-Induced Metallothionein Expression is Regulated by Specific Protein Phosphatase 2A Complexes. | ||
Sci Rep Precise and systematic survey of the efficacy of multicomponent drugs against functional dyspepsia. | ||
Biomed Res Int High STRN Expression Promotes HCC Invasion and Migration but Not Cell Proliferation or Apoptosis through Facilitating Epithelial-Mesenchymal Transition.
| ||
Kaohsiung J Med Sci CircTNPO3 promotes hepatocellular carcinoma progression by sponging miR-199b-5p and regulating STRN expression | ||
Genes (Basel) Effect of Combined Methamphetamine and Oxycodone Use on the Synaptic Proteome in an In Vitro Model of Polysubstance Use |









