Validation Data Gallery
Tested Applications
| Positive WB detected in | RAW 264.7 cells, U-937 cells, rat spleen tissue, pig spleen tissue |
| Positive IHC detected in | human lymphoma tissue, human urothelial carcinoma tissue, mouse brown adipose tissue, mouse testis tissue, rat adrenal gland tissue, rat brown adipose tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
66459-1-Ig targets STAT5A in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19546 Product name: Recombinant human STAT5A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 445-794 aa of BC027036 Sequence: ESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS 相同性解析による交差性が予測される生物種 |
| Full Name | signal transducer and activator of transcription 5A |
| Calculated molecular weight | 794 aa, 92 kDa |
| Observed molecular weight | 95 kDa |
| GenBank accession number | BC027036 |
| Gene Symbol | STAT5A |
| Gene ID (NCBI) | 6776 |
| RRID | AB_2881828 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P42229 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
STAT5A, also named as STAT5, belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5A is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different GHs. Activation of STAT5A in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of human STAT5A is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of STAT5A in cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for STAT5A antibody 66459-1-Ig | Download protocol |
| IHC protocol for STAT5A antibody 66459-1-Ig | Download protocol |
| WB protocol for STAT5A antibody 66459-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest Intrinsic RIG-I restrains STAT5 activation to modulate anti-tumor activity of CD8+ T cells | ||
J Med Chem Discovery of a Natural Small-Molecule Inhibitor to Novel Target STAT5A for Ischemic Stroke Therapy. | ||
J Agric Food Chem Dietary Glyphosate at the Regulatory "Safe" Level Worsens Colitis via a Gut Microbiota-Derived Palmitic Acid-JAK-STAT Pathway. | ||
Acta Biochim Biophys Sin (Shanghai) ZIPK collaborates with STAT5A in p53-mediated ROS accumulation in hyperglycemia-induced vascular injury
|












