Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, A549 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells |
| Positive IP detected in | PC-3 cells |
| Positive IHC detected in | human ovary tumor tissue, mouse spleen tissue, mouse colon tissue, rat colon tissue, rat spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | IFN alpha treated HeLa cells |
| Positive ChIP-qPCR detected in | IFN-γ -HT-1080 (50 ng/ml, 30min) HT-1080 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| CHIP-QPCR | CHIP-QPCR : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
Product Information
82016-1-RR targets STAT1 in WB, IHC, IF/ICC, IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0199 Product name: Recombinant human STAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-230 aa of BC002704 Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA 相同性解析による交差性が予測される生物種 |
| Full Name | signal transducer and activator of transcription 1, 91kDa |
| Calculated molecular weight | 83 kDa |
| Observed molecular weight | 84 kDa |
| GenBank accession number | BC002704 |
| Gene Symbol | STAT1 |
| Gene ID (NCBI) | 6772 |
| RRID | AB_2935597 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P42224 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
STAT1 (signal transducers and activators of transcription 1) is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. Various ligands, including interferons- and - , EGF, PDGF and IL-6, can activate STAT1. STAT1 protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for STAT1 antibody 82016-1-RR | Download protocol |
| IHC protocol for STAT1 antibody 82016-1-RR | Download protocol |
| IP protocol for STAT1 antibody 82016-1-RR | Download protocol |
| WB protocol for STAT1 antibody 82016-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Oncol (Dordr) TAK-981 potentiates doxorubicin immunocide in triple-negative breast cancer by IFN I-dependent NK cell stimulation. | ||
Cell Biochem Biophys FOXA1 Transcriptional Repression of PLSCR1 Inhibits Tongue Squamous Cell Carcinoma Progression | ||
Noncoding RNA Res LncRNA RNF144A-AS1 gene polymorphisms and their influence on lung cancer patients in the Chinese Han population | ||
Immun Inflamm Dis PLSCR1 Regulates the Physiology of Fibroblast-Like Synoviocytes via Modulating the STAT1 Signaling Pathway. |











