Validation Data Gallery
Tested Applications
| Positive WB detected in | LNCaP cells, HEK-293 cells, NIH/3T3 cells, HeLa cells, MCF-7 cells, Jurkat cells, HSC-T6 cells | 
| Positive IHC detected in | human ovary tumor tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | IFN alpha treated HeLa cells, HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:10000 | 
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 40 publications below | 
| IHC | See 6 publications below | 
| IF | See 8 publications below | 
| IP | See 2 publications below | 
| CoIP | See 1 publications below | 
| RIP | See 1 publications below | 
Product Information
66545-1-Ig targets STAT1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, pig, rabbit | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag0199 Product name: Recombinant human STAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-230 aa of BC002704 Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA相同性解析による交差性が予測される生物種 | 
| Full Name | signal transducer and activator of transcription 1, 91kDa | 
| Calculated molecular weight | 83 kDa | 
| Observed molecular weight | 84 kDa | 
| GenBank accession number | BC002704 | 
| Gene Symbol | STAT1 | 
| Gene ID (NCBI) | 6772 | 
| RRID | AB_2881907 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | P42224 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
What is the molecular weight of STAT1? Are there any isoforms of STAT1? Is STAT1 post-translationally modified?
The molecular weight of STAT1 is 91 kDa for full-length STAT1α and 84 kDa for STAT1β, which is devoid of the C-terminal activation domain (PMID: 1502203). Phosphorylation of STAT1 regulates STAT1 activity. Phosphorylation of Tyr701 by Janus kinases (JAKs) triggers STAT1 homo- and hetero-dimerization with other STAT family members and also causes nuclear translocation, while phosphorylation of Ser727 is needed for full activation (PMID: 10851062). STAT1β lacks Ser727 and has therefore been considered to be inactive or acting in a dominant negative manner to STAT1α, although it has been further shown to be capable of transcription activation in vivo (PMID: 24710278).
What is the subcellular localization of STAT1?
STAT1 is present in the cytoplasm and in the nucleus. Translocation of STAT1 from the cytoplasm to the nucleus is required for its regulation of gene expression and is dependent on phosphorylation (see above). However, low levels of unphosphorylated STAT1, often referred to as U-STAT1, can also be found in the nucleus, where U-STAT1 regulates the stability of heterochromatin by binding to chromatin in monomeric or dimeric states (PMID: 18840523).
What is the tissue expression pattern of STAT1?
STAT1 is ubiquitously expressed.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for STAT1 antibody 66545-1-Ig | Download protocol | 
| IHC protocol for STAT1 antibody 66545-1-Ig | Download protocol | 
| WB protocol for STAT1 antibody 66545-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| ACS Nano Dual Inhibition of Endoplasmic Reticulum Stress and Oxidation Stress Manipulates the Polarization of Macrophages under Hypoxia to Sensitize Immunotherapy. | ||
| Int J Biol Macromol The effect and mechanism of sanguinarine against PCV2 based on the analysis of network pharmacology and TMT quantitative proteomics | ||
| PLoS Pathog TRIM32 inhibits Venezuelan equine encephalitis virus infection by targeting a late step in viral entry | ||
| Int Immunopharmacol Silencing SIRT1 promotes the anti-HBV action of IFN-α by regulating Pol expression and activating the JAK-STAT signaling pathway | ||
| J Ethnopharmacol 4D-DIA-based Proteomics Analysis Reveals the Protective Effects of Pidanjiangtang Granules in IGT Rat Model | 











