Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HuH-7 cells, Jurkat cells, mouse spleen tissue, U-937 cells, L02 cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human colon cancer tissue, human ovary cancer tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 9 publications below |
| IHC | See 6 publications below |
| IF | See 3 publications below |
Product Information
14355-1-AP targets ST6GAL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5705 Product name: Recombinant human ST6GAL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-406 aa of BC040009 Sequence: SQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC 相同性解析による交差性が予測される生物種 |
| Full Name | ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 |
| Calculated molecular weight | 47 kDa |
| Observed molecular weight | 43-45 kDa, 50-70 kDa |
| GenBank accession number | BC040009 |
| Gene Symbol | ST6GAL1 |
| Gene ID (NCBI) | 6480 |
| RRID | AB_2194422 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15907 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ST6GAL1 (β-galactoside α-2-6 sialyl transferase1; also known as ST6N or CD75) is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta, and skeletal muscle. ST6GAL1 undergoes proteolytic process to generate soluble form from membrane form. Western blot analysis of human liver using this antibody detects both isoforms between 43-50 kDa. Higher molecular weight of bands around 50-70 kDa can also be observed with glycosylation modification. (PMID: 15049997, 23358684)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ST6GAL1 antibody 14355-1-AP | Download protocol |
| IP protocol for ST6GAL1 antibody 14355-1-AP | Download protocol |
| WB protocol for ST6GAL1 antibody 14355-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Immunity Immune checkpoint therapy-elicited sialylation of IgG antibodies impairs antitumorigenic type I interferon responses in hepatocellular carcinoma | ||
Int J Cancer Modification of α2,6-sialylation mediates the invasiveness and tumorigenicity of non-small cell lung cancer cells in vitro and in vivo via Notch1/Hes1/MMPs pathway.
| ||
Mol Cell Proteomics Integrated Systems Analysis of the Murine and Human Pancreatic Cancer Glycomes Reveals a Tumor-Promoting Role for ST6GAL1
| ||
Front Oncol High-Risk HPV16 E6 Activates the cGMP/PKG Pathway Through Glycosyltransferase ST6GAL1 in Cervical Cancer Cells.
| ||
Am J Cancer Res α1,6-Fucosyltransferase (FUT8) regulates the cancer-promoting capacity of cancer-associated fibroblasts (CAFs) by modifying EGFR core fucosylation (CF) in non-small cell lung cancer (NSCLC). | ||
Int J Food Sci Nutr Ellagic acid alleviates TNBS-induced intestinal barrier dysfunction by regulating mucin secretion and maintaining tight junction integrity in rats |












