Validation Data Gallery
Tested Applications
Positive WB detected in | PC-3 cells, C2C12 cell, COLO 320 cells |
Positive IHC detected in | mouse lung tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
IHC | See 1 publications below |
ChIP | See 1 publications below |
Product Information
26584-1-AP targets SP3 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25082 Product name: Recombinant human SP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 412-590 aa of BC126414 Sequence: IVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQ 相同性解析による交差性が予測される生物種 |
Full Name | Sp3 transcription factor |
Calculated molecular weight | 781 aa, 82 kDa |
Observed molecular weight | 70 kDa, 115 kDa |
GenBank accession number | BC126414 |
Gene Symbol | SP3 |
Gene ID (NCBI) | 6670 |
RRID | AB_2880563 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q02447 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SP3, also named as transcription factor Sp3, is a 781 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the Sp1 C2H2-type zinc-finger protein family. SP3 localizes to the nuclear periphery and in nuclear dots when sumoylated. Some localization in PML nuclear bodies. SP3 is acetylated by histone acetyltransferase p300, deacetylated by HDACs and sumoylated on all isoforms. Sumoylated on 2 sites in longer isoforms with Lys-551 being the major site. Sumoylation at this site promotes nuclear localization to the nuclear periphery, nuclear dots and PML nuclear bodies. Sumoylation on Lys-551 represses the transactivation activity, except for the largest isoform, L-Sp3, which has little effect on transactivation. Alternate sumoylation and acetylation at Lys-551 also control transcriptional activity. There exist tow modified isoform and molecular weight of those are 70 kda and 115 kda.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SP3 antibody 26584-1-AP | Download protocol |
IHC protocol for SP3 antibody 26584-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Dig Dis Sci Speckle-Type POZ Protein Down-Regulates Matrix Metalloproteinase 2 Expression via Sp1/PI3K/Akt Signaling Pathway in Colorectal Cancer. | ||
Biochem Biophys Res Commun Transcriptional activation of CSTB gene expression by transcription factor Sp3 | ||
Mol Cell Probes LINC00115 regulates lung adenocarcinoma progression via sponging miR-154-3p to modulate Sp3 expression | ||
Cell Rep LHPP-mediated inorganic pyrophosphate hydrolysis-driven lysosomal acidification in astrocytes regulates adult neurogenesis | ||
Int Immunopharmacol Menstrual blood-derived stem cells exosomal miR-let-7 to ameliorate pulmonary fibrosis through inhibiting ferroptosis by Sp3/HDAC2/Nrf2 signaling pathway | ||
PLoS Pathog The elevated expression of ORF75, a KSHV lytic gene, in Kaposi sarcoma lesions is driven by a GC-rich DNA cis element in its promoter region |