Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, human brain tissue, rat brain tissue |
| Positive IP detected in | rat brain tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 18 publications below |
| IHC | See 2 publications below |
| IF | See 10 publications below |
| IP | See 2 publications below |
| CoIP | See 3 publications below |
Product Information
12369-1-AP targets Sortilin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2997 Product name: Recombinant human SORT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 481-831 aa of BC023542 Sequence: EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE 相同性解析による交差性が予測される生物種 |
| Full Name | sortilin 1 |
| Calculated molecular weight | 831 aa, 92 kDa |
| Observed molecular weight | 100-110 kDa |
| GenBank accession number | BC023542 |
| Gene Symbol | Sortilin |
| Gene ID (NCBI) | 6272 |
| ENSEMBL Gene ID | ENSG00000134243 |
| RRID | AB_2302242 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99523 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Sortilin 1 (SORT1), is a trans-Golgi network (TGN) transmembrane protein and is a member of the Vps10p domain receptor family. SORT1 binds a number of unrelated ligands that participate in a wide range of cellular processes. It functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Sortilin antibody 12369-1-AP | Download protocol |
| IF protocol for Sortilin antibody 12369-1-AP | Download protocol |
| IHC protocol for Sortilin antibody 12369-1-AP | Download protocol |
| IP protocol for Sortilin antibody 12369-1-AP | Download protocol |
| WB protocol for Sortilin antibody 12369-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A Evidence for sortilin modulating regional accumulation of human tau prions in transgenic mice. | ||
J Cell Biol CHC22 clathrin mediates traffic from early secretory compartments for human GLUT4 pathway biogenesis. | ||
PLoS Pathog Prions amplify through degradation of the VPS10P sorting receptor sortilin.
| ||
EBioMedicine Neurotensin contributes to pediatric intestinal failure-associated liver disease via regulating intestinal bile acids uptake.
| ||












