Validation Data Gallery
Tested Applications
| Positive WB detected in | A2780 cells, MDCK cells, U-251 cells, mouse pancreas tissue, rat pancreas tissue | 
| Positive IP detected in | mouse heart tissue | 
| Positive IHC detected in | mouse heart tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 8 publications below | 
| IHC | See 2 publications below | 
| IF | See 3 publications below | 
| IP | See 3 publications below | 
Product Information
24643-1-AP targets SORBS2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, canine samples.
| Tested Reactivity | human, mouse, canine | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag20041 Product name: Recombinant human SORBS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC011883 Sequence: MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKHDWDPPDR 相同性解析による交差性が予測される生物種 | 
                                    
| Full Name | sorbin and SH3 domain containing 2 | 
| Calculated molecular weight | 1100 aa, 124 kDa | 
| Observed molecular weight | 70-75 kDa | 
| GenBank accession number | BC011883 | 
| Gene Symbol | SORBS2 | 
| Gene ID (NCBI) | 8470 | 
| RRID | AB_2879652 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O94875 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
SORBS2, also known as ARGBP2, has three C-terminal SH3 domains and an N-terminal sorbin homology (SoHo) domain that interacts with lipid raft proteins. SORBS2 is widely expressed in human tissues and extremely abundant in the heart. In epithelial cells SORBS2 is located in stress fibers and the nucleus; In cardiac muscle cells. SORBS2 is located in the Z-disks of sarcomeres. The subcellular localization suggests that SORBS2 functions as an adapter protein to assemble signaling complexes in stress fibers, and may influence the contractile or elastic properties of cardiac sarcomeres(PMID: 9211900). Alternate splicing results in multiple transcript variants( PMID: 28961272).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SORBS2 antibody 24643-1-AP | Download protocol | 
| IP protocol for SORBS2 antibody 24643-1-AP | Download protocol | 
| WB protocol for SORBS2 antibody 24643-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cell Res Oncogenic AURKA-enhanced N6-methyladenosine modification increases DROSHA mRNA stability to transactivate STC1 in breast cancer stem-like cells. | ||
EBioMedicine Elevated myocardial SORBS2 and the underlying implications in left ventricular noncompaction cardiomyopathy. | ||
Aging (Albany NY) The interaction protein of SORBS2 in myocardial tissue to find out the pathogenic mechanism of LVNC disease. | ||
J Biol Chem Arg Kinase Binding Protein 2 (ArgBP2) interaction with α-actinin and actin stress fibres inhibits cell migration. | ||
J Transl Med SORBS2 as a molecular target for atherosclerosis in patients with familial hypercholesterolemia. | ||
Mol Med Rep Musk ketone induces apoptosis of gastric cancer cells via downregulation of sorbin and SH3 domain containing 2.
  | 





