Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, mouse kidney tissue, human kidney tissue, Neuro-2a cells, K-562 cells, Jurkat cells, U2OS cells |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human kidney tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 14 publications below |
| IHC | See 1 publications below |
| IP | See 1 publications below |
Product Information
17918-1-AP targets SNX5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12330 Product name: Recombinant human SNX5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-404 aa of BC093623 Sequence: MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN 相同性解析による交差性が予測される生物種 |
| Full Name | sorting nexin 5 |
| Calculated molecular weight | 404 aa, 47 kDa |
| Observed molecular weight | 47 kDa |
| GenBank accession number | BC093623 |
| Gene Symbol | SNX5 |
| Gene ID (NCBI) | 27131 |
| RRID | AB_2192708 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5X3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX5 (Sorting nexin-5) was originally identified as a putative FANCA-binding protein (PMID: 10600472). SNX5 has a phox homology (PX) domain in the N-terminus. It is involved in several stages of intracellular trafficking. SNX5 is a component of the mammalian retromer complex, which is involved in recycling proteins from endosomes to the trans-Golgi network or plasma membrane (PMID: 17148574; 26199408).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SNX5 antibody 17918-1-AP | Download protocol |
| IHC protocol for SNX5 antibody 17918-1-AP | Download protocol |
| IP protocol for SNX5 antibody 17918-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Molecular identification of a BAR domain-containing coat complex for endosomal recycling of transmembrane proteins. | ||
Nat Commun SNX3-retromer requires an evolutionary conserved MON2:DOPEY2:ATP9A complex to mediate Wntless sorting and Wnt secretion. | ||
J Cell Biol Sequence-dependent cargo recognition by SNX-BARs mediates retromer-independent transport of CI-MPR.
| ||
Oxid Med Cell Longev Sorting Nexin 5 Plays an Important Role in Promoting Ferroptosis in Parkinson's Disease.
| ||
Cell Rep The Chlamydia effector IncE employs two short linear motifs to reprogram host vesicle trafficking |









