Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells, Raji cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human lung tissue, human brain tissue, human kidney tissue, human liver tissue, human ovary tissue, human placenta tissue, human spleen tissue, human stomach cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 2 publications below |
| RIP | See 1 publications below |
Product Information
17368-1-AP targets SNRPA1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10790 Product name: Recombinant human SNRPA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC022816 Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS 相同性解析による交差性が予測される生物種 |
| Full Name | small nuclear ribonucleoprotein polypeptide A' |
| Calculated molecular weight | 255 aa, 28 kDa |
| Observed molecular weight | 28 kDa |
| GenBank accession number | BC022816 |
| Gene Symbol | SNRPA1 |
| Gene ID (NCBI) | 6627 |
| RRID | AB_2193724 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09661 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Small nuclear ribonucleoprotein polypeptide a-prime(SNRPA1) is part of the U2 snRNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. It may be required for cell division, and helps the A' protein to bind stem loop IV of U2 snRNA. This is a rabbit polyclonal antibody raised against the full length SNRPA1 of human origin.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SNRPA1 antibody 17368-1-AP | Download protocol |
| IHC protocol for SNRPA1 antibody 17368-1-AP | Download protocol |
| IP protocol for SNRPA1 antibody 17368-1-AP | Download protocol |
| WB protocol for SNRPA1 antibody 17368-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A Inactivation of the tumor suppressor p53 by long noncoding RNA RMRP. | ||
Cell Chem Biol Novel RNA-Affinity Proteogenomics Dissects Tumor Heterogeneity for Revealing Personalized Markers in Precision Prognosis of Cancer. | ||
STAR Protoc Protocol for proteogenomic dissection of intronic splicing enhancer interactome for prediction of individualized cancer prognosis. | ||
Int Immunopharmacol Long noncoding RNA ENST00000458139 promotes mitochondrial dysfunction and apoptosis of podocytes in diabetic kidney disease through binding with SNRPA1. | ||
Clin Respir J High SNRPA1 expression leads to poor prognosis in patients with lung adenocarcinoma |
























