Recombinant human SLC22A5 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag9450
Synonyms
CDSP; FLJ46769; OCTN2; OCTN2VT
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCPDGWEFSQDVYLSTIVTEWNLVCEDDWKA
(1-142 aa encoded by BC012325) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |

