Recombinant human SIGLEC6 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag4281
Synonyms
CD327; CD33L; CD33L1; CDw327; OBBP1; SIGLEC-6
Validation Data Gallery View All
Product Information
| Peptide Sequence |
QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHST
(16-200 aa encoded by BC035359) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |

