Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse lung tissue |
| Positive IP detected in | mouse lung tissue |
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
Product Information
11839-1-AP targets Surfactant protein D in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2461 Product name: Recombinant human SFTPD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-375 aa of BC022318 Sequence: AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF 相同性解析による交差性が予測される生物種 |
| Full Name | surfactant protein D |
| Calculated molecular weight | 375 aa, 38 kDa |
| Observed molecular weight | 37-40 kDa |
| GenBank accession number | BC022318 |
| Gene Symbol | Surfactant protein D |
| Gene ID (NCBI) | 6441 |
| RRID | AB_2254351 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35247 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Surfactant protein-D (SP-D) is a pattern recognition molecule of the collectin family of C-type lectins, which consist of four structural domains: a cysteine-rich N-terminal domain, a collagen-like region, an alpha-helical coiled-coil neck domain and a C-terminal lectin or carbohydrate-recognition domain (PMID: 16213021; 15030473). SP-D is primarily expressed and secreted by type II alveolar cells (PMID: 16684127). It plays a central role in the pulmonary host defence and the modulation of allergic responses.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Surfactant protein D antibody 11839-1-AP | Download protocol |
| IHC protocol for Surfactant protein D antibody 11839-1-AP | Download protocol |
| IP protocol for Surfactant protein D antibody 11839-1-AP | Download protocol |
| WB protocol for Surfactant protein D antibody 11839-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Kub3 Deficiency Causes Aberrant Late Embryonic Lung Development in Mice by the FGF Signaling Pathway. | ||
Hum Cell Aryl hydrocarbon receptor promotes lipid droplet biogenesis and metabolic shift in respiratory Club cells. | ||
Transl Pediatr Untargeted lipidomics of bronchopulmonary dysplasia induced by hyperoxia exposure in rats | ||
Int J Chron Obstruct Pulmon Dis Effective-Component Compatibility of Bufei Yishen Formula III Protects Lung Air-Blood Barrier by Regulating the Oxidative Stress: via the Nuclear Factor-E2-Related Factor 2 Pathway | ||
Cell Biochem Funct IL-37 Protects Against Ventilator-Induced Lung Injury by Inhibiting NLRP3 Activation | ||
J Thorac Dis Deletion of LCMR1 in alveolar type II cells induces lethal impairment of lung structure and function in adult mice |





