Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse lung tissue, rat lung tissue |
| Positive IHC detected in | human lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 38 publications below |
| IHC | See 20 publications below |
| IF | See 68 publications below |
| FC | See 1 publications below |
Product Information
10774-1-AP targets SFTPC in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1159 Product name: Recombinant human SFTPC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC005913 Sequence: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI 相同性解析による交差性が予測される生物種 |
| Full Name | surfactant protein C |
| Calculated molecular weight | 21 kDa |
| Observed molecular weight | 21-25 kDa |
| GenBank accession number | BC005913 |
| Gene Symbol | SFTPC |
| Gene ID (NCBI) | 6440 |
| RRID | AB_2185497 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11686 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SFTPC (surfactant protein C), also named as SFTP2, SP5 and SP-C, is a pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. Defects in SFTPC are the cause of pulmonary surfactant metabolism dysfunction type 2 (SMDP2). Genetic variations in SFTPC are associated with respiratory distress syndrome in premature infants (RDS). Two isoforms of the human protein are produced by alternative splicing. One previous study reported that SFTPC deletion was observed in NSCLC tissues, implying that SFTPC downregulation might be involved in the progression of lung cancer. (PMID: 35081981, PMID: 31379200)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SFTPC antibody 10774-1-AP | Download protocol |
| IHC protocol for SFTPC antibody 10774-1-AP | Download protocol |
| WB protocol for SFTPC antibody 10774-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Autophagy E-cigarette aerosols induce the hydrolysis of lysosomal glycerophospholipids through PLA2G4A activation initiated by nicotine binding to CHRNA3/α3 nAchr in airway epithelial cells. | ||
Nat Commun NCX1 reverse mode promotes calcium-dependent Neutrophil Extracellular Trap formation and lung damage in chronic obstructive pulmonary disease. | ||
Nat Commun Cloned airway basal progenitor cells to repair fibrotic lung through re-epithelialization | ||
Nat Commun FGF 13 functions as a regulator of the ERK/aerobic glycolysis axis in the inflammatory state during septic lung injury. | ||
Exp Mol Med YAP1 inhibits the senescence of alveolar epithelial cells by targeting Prdx3 to alleviate pulmonary fibrosis | ||
Redox Biol Gaylussacin, a stilbene glycoside, inhibits chronic obstructive pulmonary disease in mice |