Recombinant human SF3B14 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag3045
Synonyms
CGI-110; HSPC175; Ht006; P14; SAP14; SF3B14a
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
(1-125 aa encoded by BC015463) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |

