Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, Jurkat cells, L02 cells, PC-3 cells, HepG2 cells |
| Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue, human ovary cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 5 publications below |
| ELISA | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
10673-1-AP targets Serpin A5/Protein C Inhibitor in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1078 Product name: Recombinant human SERPINA5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 106-406 aa of BC008915 Sequence: ELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP 相同性解析による交差性が予測される生物種 |
| Full Name | serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5 |
| Calculated molecular weight | 46 kDa |
| Observed molecular weight | 46 kDa |
| GenBank accession number | BC008915 |
| Gene Symbol | SERPINA5 |
| Gene ID (NCBI) | 5104 |
| RRID | AB_2185741 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05154 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SERPINA5 (also called Protein C Inhibitor, PCI ) is a serpin type of serine protease inhibitor that is found in many tissues and fluids in human, including blood plasma, seminal plasma and urine. PCI found in blood originates from the liver and is capable of inhibiting several serine proteases involved in the regulation of coagulation and fibrinolysis, including activated protein C, thrombin, factor Xa, various kallikreins and plasminogen activators. PCI has been found to have antimicrobial and antitumor properties and thus appears to be a multi-functional protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Serpin A5/Protein C Inhibitor antibody 10673-1-AP | Download protocol |
| IHC protocol for Serpin A5/Protein C Inhibitor antibody 10673-1-AP | Download protocol |
| WB protocol for Serpin A5/Protein C Inhibitor antibody 10673-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mod Pathol Loss of SerpinA5 protein expression is associated with advanced-stage serous ovarian tumors. | ||
J Neuropathol Exp Neurol Gene expression profiling of NF-1-associated and sporadic pilocytic astrocytoma identifies aldehyde dehydrogenase 1 family member L1 (ALDH1L1) as an underexpressed candidate biomarker in aggressive subtypes. | ||
Proteomics Clin Appl Proteomic analysis of human articular cartilage unravels the dyscoagulation in osteoarthritis and the potential value of serpinA5 as a biomarker for osteoarthritis. | ||
J Proteome Res Proteomics Analysis of Knee Subchondral Bone Identifies Differentially Expressed Proteins Associated with Osteoarthritis | ||
J Cell Mol Med SERPINA5 promotes tumour cell proliferation by modulating the PI3K/AKT/mTOR signalling pathway in gastric cancer | ||
Biomolecules Improvement in Clinical Features of L-NAME-Induced Preeclampsia-like Rats through Reduced SERPINA5 Expression |











