Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, Jurkat cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 93 publications below |
| IHC | See 8 publications below |
| IF | See 6 publications below |
| IP | See 2 publications below |
Product Information
10620-1-AP targets SDHB in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0968 Product name: Recombinant human SDHB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC007840 Sequence: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV 相同性解析による交差性が予測される生物種 |
| Full Name | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) |
| Calculated molecular weight | 32 kDa |
| Observed molecular weight | 28-32 kDa |
| GenBank accession number | BC007840 |
| Gene Symbol | SDHB |
| Gene ID (NCBI) | 6390 |
| RRID | AB_2285522 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21912 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SDHB(Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial) is also named as SDH, SDH1 and belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. The SDHD, SDHB, and SDHC genes encode subunits of mitochondrial complex II (succinate dehydrogenase). Mitochondrial complex II is a heterotetrameric complex involved in the aerobic electron transport chain and catalyses the oxidation of succinate to fumarate (Krebs cycle) with transport of electrons to the ubiquinone pool. SDHA and SDHB are the hydrophilic catalytic part of the complex and are highly conserved(J Med Genet 2004;41:e99). Defects in SDHB are a cause of susceptibility to pheochromocytoma (PCC), paragangliomas type 4 (PGL4), paraganglioma and gastric stromal sarcoma (PGGSS) and Cowden-like syndrome (CWDLS).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SDHB antibody 10620-1-AP | Download protocol |
| IF protocol for SDHB antibody 10620-1-AP | Download protocol |
| IHC protocol for SDHB antibody 10620-1-AP | Download protocol |
| IP protocol for SDHB antibody 10620-1-AP | Download protocol |
| WB protocol for SDHB antibody 10620-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Low chorionic villous succinate accumulation associates with recurrent spontaneous abortion risk.
| ||
Aging Dis Dietary Salt Disrupts Tricarboxylic Acid Cycle and Induces Tau Hyperphosphorylation and Synapse Dysfunction during Aging | ||
Sci Total Environ TRIM24-DTNBP1-ATP7A mediated astrocyte cuproptosis in cognition and memory dysfunction caused by Y2O3 NPs | ||
Cell Death Dis TGR5 supresses cGAS/STING pathway by inhibiting GRP75-mediated endoplasmic reticulum-mitochondrial coupling in diabetic retinopathy | ||







