Recombinant human SCP2 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag19215
Synonyms
DKFZp686C12188; DKFZp686D11188; NLTP; NSL-TP; SCPX
Validation Data Gallery
Product Information
| Peptide Sequence |
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
(405-547 aa encoded by BC005911) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
