Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, HEK-293 cells, K-562 cells, NIH/3T3 cells, HepG2 cells |
| Positive IP detected in | HepG2 cells |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 10 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
23006-1-AP targets SCP2/SCPx in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19215 Product name: Recombinant human SCP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 405-547 aa of BC005911 Sequence: MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL 相同性解析による交差性が予測される生物種 |
| Full Name | sterol carrier protein 2 |
| Calculated molecular weight | 547 aa, 59 kDa |
| Observed molecular weight | 13-15 kDa |
| GenBank accession number | BC005911 |
| Gene Symbol | SCP2 |
| Gene ID (NCBI) | 6342 |
| RRID | AB_2879197 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P22307 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SCP2 (Sterol carrier protein-2), also called nonspecific lipid-transfer protein, is thought to play a major role in intracellular lipid transport and metabolism. Mutations of SCP2 have been associated with diseases involving abnormalities in lipid trafficking, such as Zellweger syndrome. The alternative splicing generates 58 kDa SCPx and 13-15 kDa SCP2 proteins, both of which contain a C-terninal SCP2 domain. In addition to the SCP2 domain, SCPx also contains an amino-terminal thiolase domain. The proteolytic cleavage of SCPx occurred when it was imported into peroxisomes, giving rise to a 44-46 kDa thiolase and a 13-15 kDa SCP2. 23006-1-AP antibody recognizes the 13-15 kDa SCP2 protein.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SCP2/SCPx antibody 23006-1-AP | Download protocol |
| IF protocol for SCP2/SCPx antibody 23006-1-AP | Download protocol |
| IP protocol for SCP2/SCPx antibody 23006-1-AP | Download protocol |
| WB protocol for SCP2/SCPx antibody 23006-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Podophyllotoxin via SIRT1/PPAR /NF-κB axis induced cardiac injury in rats based on the toxicological evidence chain (TEC) concept | ||
Commun Biol Transmembrane protein 135 regulates lipid homeostasis through its role in peroxisomal DHA metabolism | ||
J Biol Chem Sterol carrier protein-2 deficiency attenuates diet-induced dyslipidemia and atherosclerosis in mice.
| ||
PLoS One Sterol Carrier Protein-2, a Nonspecific Lipid-Transfer Protein, in Intracellular Cholesterol Trafficking in Testicular Leydig Cells. | ||
J Biochem Human SCP4 is a chromatin-associated CTD phosphatase and exhibits the dynamic translocation during erythroid differentiation. |






