Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, HeLa cells, MCF-7 cells, A431 cells, HCT 116 cells, COLO 320 cells |
| Positive IHC detected in | mouse testis tissue, human testis tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 4 publications below |
Product Information
21857-1-AP targets SAFB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16451 Product name: Recombinant human SAFB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 58-213 aa of BC126219 Sequence: MERLKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQEIEEPSLEPE 相同性解析による交差性が予測される生物種 |
| Full Name | scaffold attachment factor B |
| Calculated molecular weight | 917 aa, 103 kDa |
| Observed molecular weight | 150 kDa |
| GenBank accession number | BC126219 |
| Gene Symbol | SAFB |
| Gene ID (NCBI) | 6294 |
| RRID | AB_2878928 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15424 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to pre-mRNA processing and transport. hnRNPs also bind heterogeneous nuclear RNA (hnRNA), the transcripts produced by RNA polymerase II. SAFB (scaffold attachment factor B) is a nuclear matrix-associated protein that binds to matrix- or scaffold-associating regions (MARs or SARs) on DNA and interacts with RNA polymerase II and serine-/arginine-rich RNA processing factors (SR proteins). SAFB, also designated HAP (hnRNP A1 associated protein) and HET (HSP 27-ERE-TATA-binding protein) is a proven hnRNP protein that has a speckled distribution in the nucleus and, in response to stress agents such as heat shock, is recruited to a few, large nuclear granules, called perichromatin granules. SAFB also binds to the estrogen receptor (ER) and is expressed in several breast cancer cell lines at varying levels. Subsequently, SAFB may play a role in breast cancer by mediating cellular proliferation and division. This antibody specifically reacts whith the isoform 1 of human SAFB protein. SF3A1, also known as SF3a120, is a 793 amino acid protein, which is a Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3A1 also be involved in the assembly of the 'E' complex. The calculated molecular weight of SAFB is 103 kDa, but the modified SAFB is about 130-175 kDa.(PMID: 28469965, PMID: 26273616 )
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SAFB antibody 21857-1-AP | Download protocol |
| IHC protocol for SAFB antibody 21857-1-AP | Download protocol |
| WB protocol for SAFB antibody 21857-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Acta Neuropathol Commun RBM45 associates with nuclear stress bodies and forms nuclear inclusions during chronic cellular stress and in neurodegenerative diseases. | ||
Neurobiol Dis ALS-linked cytoplasmic FUS assemblies are compositionally different from physiological stress granules and sequester hnRNPA3, a novel modifier of FUS toxicity. | ||
Mol Cell SAFB restricts contact domain boundaries associated with L1 chimeric transcription | ||
Cell Rep Stress-induced TDP-43 nuclear condensation causes splicing loss of function and STMN2 depletion |

















