Validation Data Gallery
Tested Applications
| Positive WB detected in | NK-92 cells, A375 cells, HeLa cells, PC-3 cells, THP-1 cells, A549 cells, NIH/3T3 cells, HSC-T6 cells | 
| Positive IHC detected in | human lung cancer tissue, human colon cancer tissue,  human tonsillitis tissue,  K-562 cells,  mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 | 
| Positive IF/ICC detected in | HepG2 cells, HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 | 
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 11 publications below | 
| IHC | See 6 publications below | 
| IF | See 16 publications below | 
| ELISA | See 1 publications below | 
| FC | See 1 publications below | 
Product Information
66489-1-Ig targets S100A4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | CatNo: Ag9019 Product name: Recombinant human S100A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC016300 Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK相同性解析による交差性が予測される生物種 | 
| Full Name | S100 calcium binding protein A4 | 
| Calculated molecular weight | 101 aa, 12 kDa | 
| Observed molecular weight | 12 kDa | 
| GenBank accession number | BC016300 | 
| Gene Symbol | S100A4 | 
| Gene ID (NCBI) | 6275 | 
| ENSEMBL Gene ID | ENSG00000196154 | 
| RRID | AB_2881854 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | P26447 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100A4 antibody 66489-1-Ig | Download protocol | 
| IHC protocol for S100A4 antibody 66489-1-Ig | Download protocol | 
| WB protocol for S100A4 antibody 66489-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
| Blood C1Q labels a highly aggressive macrophage-like leukemia population indicating extramedullary infiltration and relapse | ||
| Adv Sci (Weinh) Meis1 Targets Protein Tyrosine Phosphatase Receptor J in Fibroblast to Retard Chronic Kidney Disease Progression | ||
| Cell Death Differ Upregulation of Wilms' Tumor 1 in epicardial cells increases cardiac fibrosis in dystrophic mice. | ||
| Acta Pharmacol Sin PU.1/Spi1 exacerbates ischemia-reperfusion induced acute kidney injury via upregulating Gata2 and promoting fibroblast activation | ||
| PLoS Pathog S100A4+ macrophages facilitate zika virus invasion and persistence in the seminiferous tubules via interferon-gamma mediation. | ||
| Cancers (Basel) Usp22 Overexpression Leads to Aberrant Signal Transduction of Cancer-Related Pathways but Is Not Sufficient to Drive Tumor Formation in Mice | 























