Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, Jurkat cells, HepG2 cells, HEK-293 cells, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 8 publications below |
| IHC | See 3 publications below |
| IF | See 2 publications below |
Product Information
15494-1-AP targets RUNX1T1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7892 Product name: Recombinant human RUNX1T1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC005850 Sequence: MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREE 相同性解析による交差性が予測される生物種 |
| Full Name | runt-related transcription factor 1; translocated to, 1 (cyclin D-related) |
| Calculated molecular weight | 68 kDa |
| Observed molecular weight | 64-69 kDa |
| GenBank accession number | BC005850 |
| Gene Symbol | RUNX1T1 |
| Gene ID (NCBI) | 862 |
| RRID | AB_2184217 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q06455 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
RUNX1T1 is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. Various transcript of the fusion gene has been reported. RUNX1T1 exists some isoforms with MV 68, 67,64, 48 and 44 kDa. The calcualted molecular weight of RUNX1T1 is 67 kDa, but modified RUNX1T1is about 70-75 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RUNX1T1 antibody 15494-1-AP | Download protocol |
| IP protocol for RUNX1T1 antibody 15494-1-AP | Download protocol |
| WB protocol for RUNX1T1 antibody 15494-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res FTO-dependent demethylation of N6-methyladenosine regulates mRNA splicing and is required for adipogenesis. | ||
Int J Mol Sci Characterization of RUNX1T1, an Adipogenesis Regulator in Ovine Preadipocyte Differentiation.
| ||
Int J Biol Macromol Genome-wide analysis reveals porcine LIFR regulated by DNA methylation promotes the implantation process via the STAT3 signaling | ||
Cancer Lett HOX code-based stratification reveals RUNX1T1-HDAC reprogramming as a targetable driver of lineage plasticity across cancers.
| ||
Nat Commun The transcriptional co-repressor Runx1t1 is essential for MYCN-driven neuroblastoma tumorigenesis | ||
J Biol Chem Lactate promotes neuronal differentiation of SH-SY5Y cells by lactate-responsive gene sets through NDRG3-dependent and -independent manners |






