Validation Data Gallery
Tested Applications
| Positive WB detected in | NIH/3T3 cells, mouse pancreas tissue |
| Positive IP detected in | NIH/3T3 cells |
| Positive IHC detected in | mouse heart tissue, human heart tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
Product Information
12530-1-AP targets RRAS2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3226 Product name: Recombinant human RRAS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC013106 Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF 相同性解析による交差性が予測される生物種 |
| Full Name | related RAS viral (r-ras) oncogene homolog 2 |
| Calculated molecular weight | 204 aa, 23 kDa |
| Observed molecular weight | 23 kDa |
| GenBank accession number | BC013106 |
| Gene Symbol | RRAS2 |
| Gene ID (NCBI) | 22800 |
| RRID | AB_2180206 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62070 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Ras-related protein R-Ras2 (RRAS2) is also named TC21 and Teratocarcinoma oncogene. The RRAS2 member of the RAS-related subfamily, also known as TC21, is a close relative of the classic RAS GTPases (PMID: 3898776). RRAS2, a member of the R-Ras subfamily of Ras-like low-molecular-weight GTPases, is located in the plasma membrane and functions as a signal transducer (PMID: 38601074). RRAS2 is GTP-binding protein with GTPase activity, involved in the regulation of MAPK signaling pathway and thereby controlling multiple cellular processes (PMID: 31130282).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| IF protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| IHC protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| IP protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| WB protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Differ Global identification of phospho-dependent SCF substrates reveals a FBXO22 phosphodegron and an ERK-FBXO22-BAG3 axis in tumorigenesis. | ||
Fertil Steril Long-term effects of repeated superovulation on ovarian structure and function in rhesus monkeys. | ||
J Biol Chem Competition for cysteine acylation by C16:0 and C18:0 derived lipids is a global phenomenon in the proteome | ||
Cells Co-Inhibition of tGLI1 and GP130 Using FDA-Approved Ketoconazole and Bazedoxifene Is Synergistic Against the Growth and Metastasis of HER2-Enriched and Triple-Negative Breast Cancers | ||
Biochem Genet ETS1 Promotes Aerobic Glycolysis and Growth in Head and Neck Squamous Cell Carcinoma by Targeting RRAS2
|











