Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells, human kidney tissue, HeLa cells, Raji cells, human placenta tissue, mouse kidney tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 13 publications below |
| IHC | See 2 publications below |
| IF | See 3 publications below |
Product Information
11005-1-AP targets RPL3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1436 Product name: Recombinant human RPL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 153-403 aa of BC012786 Sequence: MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA 相同性解析による交差性が予測される生物種 |
| Full Name | ribosomal protein L3 |
| Calculated molecular weight | 46/27 kDa |
| Observed molecular weight | 46 kDa |
| GenBank accession number | BC012786 |
| Gene Symbol | RPL3 |
| Gene ID (NCBI) | 6122 |
| RRID | AB_2181760 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P39023 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3, also named as TARBP-B and MGC104284, belongs to the ribosomal protein L3P family. This protein is a component of the 60S subunit. It can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. This is a rabbit polyclonal antibody raised against the C terminus of human RPL3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RPL3 antibody 11005-1-AP | Download protocol |
| IHC protocol for RPL3 antibody 11005-1-AP | Download protocol |
| IP protocol for RPL3 antibody 11005-1-AP | Download protocol |
| WB protocol for RPL3 antibody 11005-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A Preventing translational inhibition from ribosomal protein insufficiency by a herpes simplex virus-encoded ribosome-associated protein.
| ||
Elife METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance. | ||
Aging (Albany NY) RNA-seq analysis of the key long noncoding RNAs and mRNAs related to cognitive impairment after cardiac arrest and cardiopulmonary resuscitation. | ||
Nucleic Acid Ther Knockdown of Muscle-Specific Ribosomal Protein L3-Like Enhances Muscle Function in Healthy and Dystrophic Mice. | ||
Life Sci Alliance Rapid ER remodeling induced by a peptide-lipid complex in dying tumor cells |






