Recombinant human RINT1 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag8626
Synonyms
DKFZp667H2324; RINT-1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
WLSLPSQSEQAVMSLSSSACPLLLTLRDHLLQLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGGAAQLQFDMTRNLFPLFSHYCKRPENYFKHIKEACIVLNLNVGSALLLKDVLQSASGQLPATAALNEVGIYKLAQQDVEILLNLRTNWPNTGK
(630-792 aa encoded by BC007120) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |








