Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse liver tissue, mouse small intestine tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | rat kidney tissue, human liver tissue, human kidney tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:3000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 13 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
17947-1-AP targets RGN/SMP30 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12423 Product name: Recombinant human RGN,SMP30 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC073173 Sequence: MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG 相同性解析による交差性が予測される生物種 |
| Full Name | regucalcin (senescence marker protein-30) |
| Calculated molecular weight | 299 aa, 33 kDa |
| Observed molecular weight | 33 kDa, 25 kDa |
| GenBank accession number | BC073173 |
| Gene Symbol | RGN/SMP30 |
| Gene ID (NCBI) | 9104 |
| RRID | AB_10644486 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15493 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Regucalcin (RGN), also known as SMP30, is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. SMP30 is preferentially localized in hepatocytes and renal proximal tubular epithelial cells. It is known to be related to aging, hepatocyte proliferation and tumorigenesis. It may be useful for HCC serologic screening, especially for the patients with AFP Negative. RGN encodes two isoforms: 33 kDa and 25 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RGN/SMP30 antibody 17947-1-AP | Download protocol |
| IP protocol for RGN/SMP30 antibody 17947-1-AP | Download protocol |
| WB protocol for RGN/SMP30 antibody 17947-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Transl Lung Cancer Res Senescence marker protein 30 inhibits tumor growth by reducing HDAC4 expression in non-small cell lung cancer. | ||
Ecotoxicol Environ Saf Hexavalent chromium triggers hepatocytes premature senescence via the GATA4/NF-κB signaling pathway mediated by the DNA damage response. | ||
Ecotoxicol Environ Saf Identification and functional analysis of senescence-associated secretory phenotype of premature senescent hepatocytes induced by hexavalent chromium. | ||
J Endocrinol Hepatic thyroid signaling of heat-stressed late pregnant and early lactating cows. | ||
Int Immunopharmacol Senescence marker protein 30 (SMP30) protects against high glucose-induced apoptosis, oxidative stress and inflammatory response in retinal ganglion cells by enhancing Nrf2 activation via regulation of Akt/GSK-3β pathway | ||
Toxicol Lett Dioscin, a natural steroid saponin, shows remarkable protective effect against acetaminophen-induced liver damage in vitro and in vivo. |










