Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, mouse adipose tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human colon cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human kidney tissue, human colon cancer tissue |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
14541-1-AP targets RBP7 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6045 Product name: Recombinant human RBP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC063013 Sequence: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA 相同性解析による交差性が予測される生物種 |
| Full Name | retinol binding protein 7, cellular |
| Calculated molecular weight | 15.5 kDa |
| Observed molecular weight | 15-18 kDa |
| GenBank accession number | BC063013 |
| Gene Symbol | RBP7 |
| Gene ID (NCBI) | 116362 |
| RRID | AB_2179293 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96R05 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
RBP7(Retinol Binding Protein 7), also known as CRBP4 or CRBP4, belongs to the cell retinol binding protein (CRBP) family. Its structure is a typical β-barrel, which can bind all-trans retinol, but its affinity is lower than other CRBP members. RBP7 is mainly located in cytoplasm, and has secretory characteristics, and is highly expressed in adipose tissue (white/brown), kidney, heart and other tissues. Functionally, it is responsible for the stability and transport of retinol in cells and provides substrates for LRAT to form retinyl esters. At the same time, it is regulated by PPARγ, which promotes preadipocyte differentiation and triglyceride accumulation, and mediates vascular endothelial protection through adiponectin. In terms of diseases, the expression of RBP7 is up-regulated in many hepatocellular carcinoma cell lines, but the level is low in normal hepatocytes L02. As a key chaperone protein of retinol metabolic pathway, RBP7 is a potential target for metabolic diseases and tumor research.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RBP7 antibody 14541-1-AP | Download protocol |
| IHC protocol for RBP7 antibody 14541-1-AP | Download protocol |
| IP protocol for RBP7 antibody 14541-1-AP | Download protocol |
| WB protocol for RBP7 antibody 14541-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancers (Basel) Integrated Pan-Cancer Analysis and Experimental Verification of the Roles of Retinoid-Binding Proteins in Breast Cancer. | ||
Cancer Cell Int RBP7 functions as a tumor suppressor in HR + breast cancer by inhibiting the AKT/SREBP1 pathway and reducing fatty acid |