Validation Data Gallery
Tested Applications
| Positive WB detected in | CHO cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
12572-1-AP targets EPAC1 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat, hamster samples.
| Tested Reactivity | human, mouse, rat, hamster |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3240 Product name: Recombinant human RAPGEF3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 441-788 aa of BC017728 Sequence: HFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQVLVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDLVSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALE 相同性解析による交差性が予測される生物種 |
| Full Name | Rap guanine nucleotide exchange factor (GEF) 3 |
| Calculated molecular weight | 881 aa, 99 kDa |
| Observed molecular weight | 99-104 kDa |
| GenBank accession number | BC017728 |
| Gene Symbol | EPAC1/RAPGEF3 |
| Gene ID (NCBI) | 10411 |
| RRID | AB_11232407 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95398 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
EPAC1 functions as a guanine nucleotide exchange factor (GEF), activating small GTPases like Rap1 and Rap2, leading to diverse cellular response. Epac proteins are cAMP sensors that regulate several pivotal cellular processes, including calcium handling, cell proliferation, cell survival, cell differentiation, cell polarization, cell adhesion events, gene transcription, secretion, ion transport, and neuronal signaling. It is a potential target for therapeutic intervention, such as metabolic disorders, cardiovascular diseases (PMID: 20007405, PMID: 20421979). EPAC1 also enhances brown fat growth and beige adipogenesis (PMID: 38195707).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EPAC1 antibody 12572-1-AP | Download protocol |
| IHC protocol for EPAC1 antibody 12572-1-AP | Download protocol |
| WB protocol for EPAC1 antibody 12572-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Ethnopharmacol Manshenkang granules alleviate fibrosis in chronic renal failure rats by regulating the PDE4b/cAMP pathway | ||
Fitoterapia QiShenYiQi dripping pills ameliorate post-myocardial infarction cardiac fibrosis via modulation of the cAMP/Rap1 and PI3K/Akt signaling pathways. | ||
Pharmacol Res Ginsenoside Ro prevents endothelial injury via promoting Epac1/AMPK- mediated mitochondria protection in early diabetic retinopathy | ||
Sci Rep Selective antagonism of adenosine A2A receptor reduces hypobaric hypoxia-induced neuroinflammation by inhibiting cGAS-STING pathway. | ||
Cell Mol Life Sci Inhibition of DYRK1B BY C81 impedes inflammatory processes in leukocytes by reducing STAT3 activity | ||
Transl Cancer Res Mechanistic study of the role of emodin in targeting and inhibiting the Rap1 signaling pathway to regulate epithelial-mesenchymal transition and reverse cisplatin resistance in hepatocellular carcinoma. |





