Validation Data Gallery
Tested Applications
| Positive WB detected in | SH-SY5Y cells, human brain tissue, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 9 publications below |
| IP | See 1 publications below |
Product Information
16117-1-AP targets RAC1/2/3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9045 Product name: Recombinant human RAC1/2/3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC015197 Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF 相同性解析による交差性が予測される生物種 |
| Full Name | ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) |
| Calculated molecular weight | 192 aa, 21 kDa |
| Observed molecular weight | 21 kDa |
| GenBank accession number | BC015197 |
| Gene Symbol | RAC3 |
| Gene ID (NCBI) | 5881 |
| RRID | AB_2176154 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60763 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Rac3 is a GTPase that belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. There are three Rac genes in mammals, which share over 90% protein identity but differ for their pattern of expression. Rac1 is ubiquitous, Rac2 is specific for hematopoietic cells, while Rac3 is prevalent in the developing nervous system. This antibody can recognize Rac1, Rac2, and Rac3.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for RAC1/2/3 antibody 16117-1-AP | Download protocol |
| WB protocol for RAC1/2/3 antibody 16117-1-AP | Download protocol |
| IHC protocol for RAC1/2/3 antibody 16117-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cancer F-box protein complex FBXL19 regulates TGFβ1-induced E-cadherin down-regulation by mediating Rac3 ubiquitination and degradation. | ||
Front Cell Neurosci A Method to Culture GABAergic Interneurons Derived from the Medial Ganglionic Eminence.
| ||
Mol Biol Cell Phosphorylated cortactin recruits Vav2 guanine nucleotide exchange factor to activate Rac3 and promote invadopodial function in invasive breast cancer cells.
| ||
BMC Cancer Rac3 induces a molecular pathway triggering breast cancer cell aggressiveness: differences in MDA-MB-231 and MCF-7 breast cancer cell lines. | ||
Glycoconj J Gangliosides in the differentiation process of primary neurons: the specific role of GM1-oligosaccharide. | ||
Asian Pac J Cancer Prev Silencing of rac3 inhibits proliferation and induces apoptosis of human lung cancer cells.
|





