Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HL-60 cells, mouse spleen tissue, rat spleen tissue |
| Positive IP detected in | HL-60 cells |
| Positive IHC detected in | human tonsillitis tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 8 publications below |
Product Information
10735-1-AP targets RAC2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1202 Product name: Recombinant human RAC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC001485 Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL 相同性解析による交差性が予測される生物種 |
| Full Name | ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
| Calculated molecular weight | 21 kDa |
| Observed molecular weight | 21 kDa |
| GenBank accession number | BC001485 |
| Gene Symbol | RAC2 |
| Gene ID (NCBI) | 5880 |
| RRID | AB_2176127 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15153 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
RAC2, also named as GX, belongs to the small GTPase superfamily and Rho family. RAC2 is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. RAC2 augments the production of reactive oxygen species (ROS) by NADPH oxidase. Defects in RAC2 are the cause of neutrophil immunodeficiency syndrome. This target can exhibit cross-reactions with RAC1 and RAC3.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RAC2 antibody 10735-1-AP | Download protocol |
| IP protocol for RAC2 antibody 10735-1-AP | Download protocol |
| WB protocol for RAC2 antibody 10735-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Genet In vivo RNAi screening identifies regulators of actin dynamics as key determinants of lymphoma progression.
| ||
J Exp Clin Cancer Res Long noncoding RNA AFAP1-AS1 acts as a competing endogenous RNA of miR-423-5p to facilitate nasopharyngeal carcinoma metastasis through regulating the Rho/Rac pathway. | ||
Front Mol Neurosci Quantitative Proteomic Analysis of Mouse Sciatic Nerve Reveals Post-injury Upregulation of ADP-Dependent Glucokinase Promoting Macrophage Phagocytosis. | ||
Oncol Rep Upregulation and hypomethylation of lncRNA AFAP1‑AS1 predicts a poor prognosis and promotes the migration and invasion of cervical cancer. | ||
Biochem Biophys Res Commun Hsa_circ_001659 serves as a novel diagnostic and prognostic biomarker for colorectal cancer. | ||
Tumour Biol AFAP1-AS1, a long noncoding RNA upregulated in lung cancer and promotes invasion and metastasis. |





