Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, human peripheral blood platelets, MCF-7 cells, HeLa cells, U-87 MG cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-87 MG cells, A431 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IF | See 3 publications below |
Product Information
66944-1-Ig targets RAB27B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18756 Product name: Recombinant human RAB27B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-218 aa of BC027474 Sequence: MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC 相同性解析による交差性が予測される生物種 |
| Full Name | RAB27B, member RAS oncogene family |
| Calculated molecular weight | 218 aa, 25 kDa |
| Observed molecular weight | 25 kDa |
| GenBank accession number | BC027474 |
| Gene Symbol | RAB27B |
| Gene ID (NCBI) | 5874 |
| RRID | AB_2882268 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O00194 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The Rab27 GTPase subfamily consists of two closely related homologs, Rab27a and Rab27b. Northern blot analysis revealed that Rab27b is expressed significantly only in testis, in which the predominant transcript was 1.4 kb in size. An 8-kb mRNA of unknown origin was detected in many tissues. Rab27b is associated with tubulovesicle membranes in the parietal cell and Rab27b may play a role in stimulation-associated membrane recruitment and gastric acid secretion. Rab27b is recently reported as a marker for breast cancer progression. It regulates invasive growth and metastasis in ER-positive breast cancer cell lines, and increased expression is associated with poor prognosis in humans.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for RAB27B antibody 66944-1-Ig | Download protocol |
| IF protocol for RAB27B antibody 66944-1-Ig | Download protocol |
| IHC protocol for RAB27B antibody 66944-1-Ig | Download protocol |
| WB protocol for RAB27B antibody 66944-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell An Epstein-Barr virus protein interaction map reveals NLRP3 inflammasome evasion via MAVS UFMylation | ||
J Biol Chem The GTPase Rab27b regulates the release, autophagic clearance, and toxicity of α-synuclein.
| ||
FEBS Open Bio Rab44 isoforms similarly promote lysosomal exocytosis, but exhibit differential localization in mast cells. | ||
Front Cell Infect Microbiol Uropathogenic Escherichia coli infection: innate immune disorder, bladder damage, and Tailin Fang II | ||
Am J Reprod Immunol Rab27b promotes endometriosis by enhancing invasiveness of ESCs and promoting angiogenesis |






