Validation Data Gallery
Tested Applications
| Positive WB detected in | HCT 116 cells, LNCaP cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, HEK-293 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10400 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
67599-1-Ig targets PRX5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12262 Product name: Recombinant human Prx5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-214 aa of BC110983 Sequence: MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL 相同性解析による交差性が予測される生物種 |
| Full Name | peroxiredoxin 5 |
| Calculated molecular weight | 214 aa, 22 kDa |
| Observed molecular weight | 17 kDa |
| GenBank accession number | BC110983 |
| Gene Symbol | PRX5 |
| Gene ID (NCBI) | 25824 |
| RRID | AB_2882805 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P30044 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Peroxiredoxin 5 (Prx5) is a member of a family consisting of six antioxidant enzymes. Prx5 is ubiquitously expressed in various tissues including mitochondria and peroxisomes, implying that Prx5 functions as a regulator of the cellular oxidation state. Prx5 plays a critical role in protecting cells from oxidative stress by inhibiting the accumulation of reactive oxygen species and cell death. Prx5 has an intensive ROS scavenging activity because it is located in the cytosol and mitochondria. Prx5 expression was upregulated during adipogenesis and Prx5 overexpression suppressed adipogenesis by regulating cytosolic and mitochondrial ROS generation. (PMID: 29777756, PMID: 31505325, PMID: 22020876)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PRX5 antibody 67599-1-Ig | Download protocol |
| IHC protocol for PRX5 antibody 67599-1-Ig | Download protocol |
| WB protocol for PRX5 antibody 67599-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
Cancer Med Characterization of the Biochemical Recurrence Prediction Ability and Progression Correlation of Peroxiredoxins Family in Prostate Cancer Based on Integrating Single-Cell RNA-Seq and Bulk RNA-Seq Cohorts | ||
Int J Biol Macromol Prebiotic stachyose inhibits PRDX5 activity and castration-resistant prostate cancer development | ||
Protein Expr Purif Purification and characterization of the peroxiredoxin 5-thioredoxin 2 complex: unraveling the redox regeneration of peroxiredoxin 5 by thioredoxin 2 within the peroxiredoxin catalytic cycle. | ||
Brain Res Bull Peroxiredoxin-5 alleviates early brain injury after subarachnoid hemorrhage by reducing oxidative stress | ||
Br J Cancer Elevated serum levels of GPX4, NDUFS4, PRDX5, and TXNRD2 as predictive biomarkers for castration resistance in prostate cancer patients: an exploratory study |





