Validation Data Gallery
Tested Applications
| Positive IHC detected in | human tonsillitis tissue, human appendicitis tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse small intestine tissue |
| Positive FC detected in | MG-63 cells, A-253 cells, U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) | FC : 0.2 μg per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 4 publications below |
| IF | See 1 publications below |
Product Information
67432-1-Ig targets Podoplanin in WB, IHC, IF-P, FC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17691 Product name: Recombinant human PDPN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 101-238 aa of BC022812 Sequence: TGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGGIIVVVMRKMSGRYSP 相同性解析による交差性が予測される生物種 |
| Full Name | podoplanin |
| Calculated molecular weight | 238 aa, 25 kDa |
| GenBank accession number | BC022812 |
| Gene Symbol | Podoplanin |
| Gene ID (NCBI) | 10630 |
| RRID | AB_2882670 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q86YL7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Podoplanin was identified as a glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels. The antibody is specific to Podoplanin.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Podoplanin antibody 67432-1-Ig | Download protocol |
| IF protocol for Podoplanin antibody 67432-1-Ig | Download protocol |
| IHC protocol for Podoplanin antibody 67432-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
CNS Neurosci Ther Exosome-transmitted podoplanin promotes tumor-associated macrophage-mediated immune tolerance in glioblastoma | ||
Am J Pathol SET domain-containing 5 (SETD5) facilitates tumor growth and pulmonary metastasis through up-regulation of AKT1 signaling in breast cancer. | ||
Cell Death Dis FASN promotes lymph node metastasis in cervical cancer via cholesterol reprogramming and lymphangiogenesis. | ||
ACS Sens Proximity Effect-Mediated DNA Self-Assembly for the Highly Specific Detection of Glioma-Derived Exosomes by Combining Multiple Exosomal Surface Markers. | ||
Drug Resist Updat PDPN positive CAFs contribute to HER2 positive breast cancer resistance to trastuzumab by inhibiting antibody-dependent NK cell-mediated cytotoxicity | ||
Nat Commun Lymph nodes molecular subtypes unravel lymph nodes heterogeneity and clinical implications in colorectal cancer |















