Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, PC-3 cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, pig brain tissue |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 4 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
67736-1-Ig targets PTGES3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7870 Product name: Recombinant human PTGES3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-160 aa of BC003005 Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE 相同性解析による交差性が予測される生物種 |
| Full Name | prostaglandin E synthase 3 (cytosolic) |
| Calculated molecular weight | 19 kDa |
| Observed molecular weight | 22 kDa |
| GenBank accession number | BC003005 |
| Gene Symbol | PTGES3 |
| Gene ID (NCBI) | 10728 |
| RRID | AB_2918505 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q15185 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
P23, encoded by the gene PTGES3, plays a key role in glucocorticoid signaling and was increased at the mRNA level in the DLPFC in individuals with schizophrenia (PMID: 24345775). In the GR heterocomplex in vitro, p23 is an obligatory co-factor19 and is the limiting component of the complex44, functioning to stabilize the interaction of the complex with GR in the cytoplasm. Paradoxically, p23 also acts in the nucleus to inhibit GR-mediated gene transcription and disassemble GR transcriptional machinery in the nucleus (PMID: 12077419). In vivo, p23 is critical for appropriate glucocorticoid responsiveness (PMID: 17000766).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PTGES3 antibody 67736-1-Ig | Download protocol |
| IHC protocol for PTGES3 antibody 67736-1-Ig | Download protocol |
| WB protocol for PTGES3 antibody 67736-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol High expression of PTGES3 is an independent predictive poor prognostic biomarker and correlates with immune infiltrates in lung adenocarcinoma. | ||
Curr Pharm Des Integrated Metabolomics and Proteomics to Decipher Simiao Pill Improving Lipid Homeostasis through PTGES3-mediated Arachidonic Acid Metabolism in AIA Model | ||
J Transl Med The integration of multidisciplinary approaches revealed PTGES3 as a novel drug target for breast cancer treatment | ||
Acta Pharm Sin B RBM14 enhances transcriptional activity of p23 regulating CXCL1 expression to induce lung cancer metastasis.
| ||
Sci Rep Integrating single-cell RNA-Seq and bulk RNA-Seq data to explore the key role of fatty acid metabolism in hepatocellular carcinoma | ||
Cell Death Discov METTL9-SLC7A11 axis promotes hepatocellular carcinoma progression through ferroptosis inhibition |





