Validation Data Gallery
Tested Applications
| Positive WB detected in | rat brain tissue, mouse brain tissue, mouse heart tissue, rat heart tissue | 
| Positive IP detected in | mouse heart tissue | 
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | A549 cells, HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 6 publications below | 
Product Information
15216-1-AP targets PTGES3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag7384 Product name: Recombinant human PTGES3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC003005 Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE 相同性解析による交差性が予測される生物種 | 
                                    
| Full Name | prostaglandin E synthase 3 (cytosolic) | 
| Calculated molecular weight | 19 kDa | 
| Observed molecular weight | 21-23 kDa | 
| GenBank accession number | BC003005 | 
| Gene Symbol | PTGES3 | 
| Gene ID (NCBI) | 10728 | 
| RRID | AB_2284772 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q15185 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
P23, encoded by the gene PTGES3, plays a key role in glucocorticoid signaling and was increased at the mRNA level in the DLPFC in individuals with schizophrenia (PMID: 24345775). In the GR heterocomplex in vitro, p23 is an obligatory co-factor19 and is the limiting component of the complex44, functioning to stabilize the interaction of the complex with GR in the cytoplasm. Paradoxically, p23 also acts in the nucleus to inhibit GR-mediated gene transcription and disassemble GR transcriptional machinery in the nucleus (PMID: 12077419). In vivo, p23 is critical for appropriate glucocorticoid responsiveness (PMID: 17000766).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PTGES3 antibody 15216-1-AP | Download protocol | 
| IHC protocol for PTGES3 antibody 15216-1-AP | Download protocol | 
| IP protocol for PTGES3 antibody 15216-1-AP | Download protocol | 
| WB protocol for PTGES3 antibody 15216-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cell Death Differ Cullin 4b-RING ubiquitin ligase targets IRGM1 to regulate Wnt signaling and intestinal homeostasis. | ||
Oncotarget Quantitative proteomics reveals molecular mechanism of gamabufotalin and its potential inhibition on Hsp90 in lung cancer. | ||
Heliyon The inhibitory effects of Orengedokuto on inducible PGE2 production in BV-2 microglial cells. | ||
Sci Adv PES1 is a critical component of telomerase assembly and regulates cellular senescence. | ||
NPJ Precis Oncol Integrating bulk, single-cell, and spatial transcriptomics to identify and functionally validate novel targets to enhance immunotherapy in NSCLC
  | 










