Validation Data Gallery
Tested Applications
| Positive WB detected in | A375 cells, rat liver tissue, U-87 MG cells, HL-60 cells, MCF-7 cells, SK-BR-3 cells |
| Positive IP detected in | HL-60 cells |
| Positive IHC detected in | human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 29 publications below |
| IHC | See 8 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
14513-1-AP targets PSPH in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5972 Product name: Recombinant human PSPH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC063614 Sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE 相同性解析による交差性が予測される生物種 |
| Full Name | phosphoserine phosphatase |
| Calculated molecular weight | 25 kDa |
| Observed molecular weight | 25-28 kDa |
| GenBank accession number | BC063614 |
| Gene Symbol | PSPH |
| Gene ID (NCBI) | 5723 |
| RRID | AB_2171464 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P78330 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PSPH (phosphoserine phosphatase) is an enzyme, which is involved in the process of L-serine biosynthesis. PSPH mainly plays role in multiple aspects of cell behaviours such as proliferation and differentiation by producing precursors for the biosynthesis of diverse compounds including neurotransmitters, glycolipids and thymidine (PMID: 11237721, PMID: 19963421). Additionally, augmented PSPH level is correlated with the prognosis in multiple cancers including cutaneous squamous cell carcinoma (PMID: 21726982), breast cancer (PMID: 28931725), non-small cell lung cancer (PMID: 30662358), colorectal cancer (PMID: 24146633) and hepatocellular carcinoma (PMID: 25793315).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PSPH antibody 14513-1-AP | Download protocol |
| IF protocol for PSPH antibody 14513-1-AP | Download protocol |
| IHC protocol for PSPH antibody 14513-1-AP | Download protocol |
| IP protocol for PSPH antibody 14513-1-AP | Download protocol |
| WB protocol for PSPH antibody 14513-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science mTORC1 induces purine synthesis through control of the mitochondrial tetrahydrofolate cycle. | ||
Cell Metab Epstein-Barr-Virus-Induced One-Carbon Metabolism Drives B Cell Transformation. | ||
Cell Metab Serine metabolism antagonizes antiviral innate immunity by preventing ATP6V0d2-mediated YAP lysosomal degradation. | ||
Nat Commun Phosphoglycerate dehydrogenase activates PKM2 to phosphorylate histone H3T11 and attenuate cellular senescence | ||
Nat Commun PHGDH arginine methylation by PRMT1 promotes serine synthesis and represents a therapeutic vulnerability in hepatocellular carcinoma | ||
Mol Cell The long noncoding RNA glycoLINC assembles a lower glycolytic metabolon to promote glycolysis. |







