Validation Data Gallery
Tested Applications
| Positive WB detected in | HL-60 cells, rat spleen tissue, mouse kidney tissue, mouse liver tissue, mouse lung tissue, mouse spleen tissue, rat liver tissue, Raji cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human spleen tissue, human tonsillitis tissue, human renal cell carcinoma tissue, mouse bladder tissue, mouse stomach tissue, rat stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 15 publications below |
| IHC | See 5 publications below |
| IF | See 4 publications below |
Product Information
14544-1-AP targets PSMB9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6048 Product name: Recombinant human PSMB9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC065513 Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE 相同性解析による交差性が予測される生物種 |
| Full Name | proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) |
| Calculated molecular weight | 23 kDa |
| Observed molecular weight | 20-23 kDa |
| GenBank accession number | BC065513 |
| Gene Symbol | PSMB9 |
| Gene ID (NCBI) | 5698 |
| RRID | AB_2268925 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P28065 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PSMB9 antibody 14544-1-AP | Download protocol |
| IHC protocol for PSMB9 antibody 14544-1-AP | Download protocol |
| IP protocol for PSMB9 antibody 14544-1-AP | Download protocol |
| WB protocol for PSMB9 antibody 14544-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell DNA damage promotes HLA class I presentation by stimulating a pioneer round of translation-associated antigen production.
| ||
Nucleic Acids Res CSNK2B modulates IRF1 binding to functional DNA elements and promotes basal and agonist-induced antiviral signaling | ||
Cell Res In-cell infection: a novel pathway for Epstein-Barr virus infection mediated by cell-in-cell structures. | ||
EMBO J Proteasomal degradation within endocytic organelles mediates antigen cross-presentation. | ||
Cancer Lett Deciphering the tumor-suppressive role of PSMB9 in melanoma through multi-omics and single-cell transcriptome analyses | ||














