Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HCT 116 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 5 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
67619-1-Ig targets PSAT1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat, pig samples.
| Tested Reactivity | human, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14076 Product name: Recombinant human PSAT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-370 aa of BC001618 Sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL 相同性解析による交差性が予測される生物種 |
| Full Name | phosphoserine aminotransferase 1 |
| Calculated molecular weight | 370 aa, 40 kDa |
| Observed molecular weight | 37-40 kDa |
| GenBank accession number | BC001618 |
| Gene Symbol | PSAT1 |
| Gene ID (NCBI) | 29968 |
| RRID | AB_2882821 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9Y617 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PSAT1, also named as PSA and PSAT, belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family and SerC subfamily. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. PSAT1 represents a new interesting target for CRC therapy. (PMID:18221502) It may be implicated in altered serine metabolism and schizophrenia spectrum conditions. (PMID:20955740 )
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PSAT1 antibody 67619-1-Ig | Download protocol |
| IF protocol for PSAT1 antibody 67619-1-Ig | Download protocol |
| IHC protocol for PSAT1 antibody 67619-1-Ig | Download protocol |
| WB protocol for PSAT1 antibody 67619-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Exp Mol Med The m6A writer RBM15 drives the growth of triple-negative breast cancer cells through the stimulation of serine and glycine metabolism | ||
Cancer Biother Radiopharm Prognostic Signature in Osteosarcoma Based on Amino Acid Metabolism-Associated Genes | ||
Naunyn Schmiedebergs Arch Pharmacol Andrographolide blocked the progression of endometriosis by promoting ferroptosis via inhibiting anabolism of serine. | ||
Cancer Metab Serine starvation suppresses the progression of esophageal cancer by regulating the synthesis of purine nucleotides and NADPH
| ||
Thorac Cancer Exosomal ERBB2IP contributes to tumor growth via elevating PSAT1 expression in non-small cell lung carcinoma | ||
Int J Biol Sci Cancer-associated Fibroblast-like Cells Promote Osteosarcoma Metastasis by Upregulation of Phosphoserine Aminotransferase 1 and Activation of the mTOR/S6K Pathway.
|



