Validation Data Gallery
Tested Applications
| Positive WB detected in | A375 cells |
| Positive IP detected in | A375 cells, mouse spleen tissue |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A375 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
| IHC | See 3 publications below |
| CoIP | See 1 publications below |
Product Information
27024-1-AP targets PRPS2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25785 Product name: Recombinant human PRPS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 143-273 aa of BC119662 Sequence: IPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVV 相同性解析による交差性が予測される生物種 |
| Full Name | phosphoribosyl pyrophosphate synthetase 2 |
| Observed molecular weight | 30-34 kDa |
| GenBank accession number | BC119662 |
| Gene Symbol | PRPS2 |
| Gene ID (NCBI) | 5634 |
| RRID | AB_2880726 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11908 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PRPS (phosphoribosyl pyrophosphate synthetase) proteins catalyze the synthesis of phosphoribosyl pyrophosphate (PRPP). Three human PRPS isoforms exist and are encoded by three different genes. PRPS1 and PRPS2 (also known as PRS1 and PRS2, respectively) are ubiquitously expressed, while PRPS3 (also known as PRPS1L1) is specific to the testis. PRPP is an important substrate synthesized from MgATP and ribose-5-phosphate in a reaction that requires inorganic phosphate and magnesium as a cofactor. PRPP is essential in the synthesis of nearly all nucleotides, implying that PRPS proteins play an important role in nucleotide biosynthesis and purine metabolism. PRPS2 is a 318 amino acid protein that exists as a homodimer and a hexamer composed of three homodimers.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PRPS2 antibody 27024-1-AP | Download protocol |
| IHC protocol for PRPS2 antibody 27024-1-AP | Download protocol |
| IP protocol for PRPS2 antibody 27024-1-AP | Download protocol |
| WB protocol for PRPS2 antibody 27024-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Adv NOTCH1-driven UBR7 stimulates nucleotide biosynthesis to promote T cell acute lymphoblastic leukemia. | ||
PLoS Biol Nucleotide de novo synthesis increases breast cancer stemness and metastasis via cGMP-PKG-MAPK signaling pathway.
| ||
Front Cell Dev Biol Thyroid Hormone-Regulated Expression of Period2 Promotes Liver Urate Production. | ||
Nat Commun Identification of purine biosynthesis as an NADH-sensing pathway to mediate energy stress
| ||
Phytomedicine Pseudoginsenoside F11 enhances YBX1-mediated transcriptional repression of PRPS2 to inhibit the stemness and pulmonary metastasis of triple- negative breast cancer. |




